Grassrootscannabis.com

Grassrootscannabis.com has server used 146.148.93.148 (United States) ping response time Hosted in Google LLC Register Domain Names at GoDaddy.com, LLC. This domain has been created 6 years, 33 days ago, remaining 331 days. You can check the 7 Websites and blacklist ip address on this server

Domain information

Registrar WHOIS Server: whois.godaddy.com

Registrar URL: http://www.godaddy.com     See All 2,280,668+

Creation Date: 2016-08-29 6 years, 33 days

Updated Date: 2022-08-30 32 days ago

Expiry Date: 2023-08-29 331 days left     See All

  Sign up for notifications near expiration

Registrar: GoDaddy.com, LLC

Abuse Email: [email protected]

Abuse Phone: 480-624-2505

  Full details

Top 10 Hosting Providers

Registrar URLDomain CountsRegistrar NameAbuse Email
www.godaddy.com2,280,668GoDaddy.com, LLC[email protected]
www.tucows.com535,579Tucows Domains Inc.
networksolutions.com526,027Network Solutions, LLC[email protected]
www.namecheap.com333,839NameCheap, Inc.[email protected]
www.enom.com299,925eNom, LLC
www.publicdomainregistry.com294,948PDR Ltd. d/b/a PublicDomainRegistry.com[email protected]
www.whois.godaddy.com174,077GoDaddy.com, LLC[email protected]
www.fastdomain.com161,753FastDomain Inc.[email protected]
www.ionos.com159,2071&1 IONOS SE[email protected]
www.networksolutions.com149,653Network Solutions, LLC[email protected]

Full view & Download

Keywords Suggestions

Grassroots cannabis

Grassrootscannabis.com

Grassroots cannabis sudbury

Grassroots cannabis pa

Grassroots cannabis windsor

Grassroots cannabis curaleaf

Grassroots cannabis locations

Grassroots cannabis illinois

Grassroots cannabis new strains

Grassroots cannabis logo

Grassroots cannabis leduc

Grassroots cannabis chambersburg pa

Grassroots cannabis chicago

Grassroots cannabis reviews

( Please select at least 2 keywords )

See More:   A   B   C   D   E   F   G   H   I   J   K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z  

Hosting Provider

NetName: GOOGLE-CLOUD

Organization: Google LLC     See All 681,421+

Provider URL: Google.com

Hostname: 148.93.148.146.bc.googleusercontent.com

IP Server: 146.148.93.148 Reg: 2014-03-26, Updated: 2015-09-21

Blacklist: Check Backlist Status

Country: United States

Address: 1600 Amphitheatre Parkway, Mountain View, CA 94043, US

Latitude: 37.419201

Longitude: -122.057404

Name Server:

  • NS1-03.AZURE-DNS.COM
  • NS2-03.AZURE-DNS.NET
  • NS3-03.AZURE-DNS.ORG
  • NS4-03.AZURE-DNS.INFO

Abuse Email: [email protected]

Abuse Phone: +1-650-253-0000

Top 10 Hosting Providers

Website URLDomain CountsOrganizationAbuse Email
Google.com681,421Google LLC[email protected]
Godaddy.com650,706GoDaddy.com, LLC[email protected]
Cloudflare.com637,900Cloudflare, Inc.[email protected]
Endurance.com488,827The Endurance International Group, Inc.[email protected]
Amazon.com439,891Amazon Technologies Inc.[email protected]
297,405Domain Name Services
Amazonaws.com287,121Amazon Technologies Inc.[email protected]
Liquidweb.com159,971Liquid Web, L.L.C[email protected]
Squarespace.com150,667Squarespace, Inc.[email protected]
Ripe.net128,362RIPE Network Coordination Centre[email protected]

Full view & Download

List of found email addresses

No Emails Found

Find Websites hosted

1: Savethepoudre.org

2: Graphicworks.net

3: Bocodems.org

4: Reoinc.com

5: Grassrootscannabis.com

6: Rebeccafolsom.com

7: Campecho.com

At least 7 Sites on this server

Port Scanner (IP: 146.148.93.148)

Grassroots Cannabis

  • Curaleaf completes the acquisition of Grassroots Jul 23 2020
  • Presence Across 23 States with Over 135 Dispensary Locations and Licenses Mitchell Kahn, Grassroots …

Grassrootscannabis.com   DA: 26 PA: 26 MOZ Rank: 52

Grassroots Home » GrassRoots Cannabis Store

  • GrassRoots Cannabis Store has the best selectionof cannaibsis flower, cannabis pre-rolls, cannabis vapes and concentrates , and edibles in Windsor Ontario

Grassrootswindsor.com   DA: 21 PA: 21 MOZ Rank: 43

Marijuana Dispensary Albuquerque, NM, Cannabis …

  • For top quality cannabis near me in New Mexico, stop by Grass Roots! Grass Roots is your network of support across Albuquerque, Gallup, and Grants, NM
  • We’re here to set your mind …

Grassrootsrxnm.com   DA: 18 PA: 18 MOZ Rank: 38

Login GRASS ROOTS LAWN SERVICE

Please log in with your current username and password to get started.

Grassrootslawnservice.manageandpaymyaccount.com   DA: 47 PA: 20 MOZ Rank: 70

Grassroots Cannabis: Live Deeply Leafly

  • We’re Grassroots, a cannabis company with soul, born in Illinois and growing nationally from the ground up
  • We’re a welcoming community from different backgrounds, rooted together in a …

Leafly.com   DA: 14 PA: 18 MOZ Rank: 36

Grass Roots Marijuana Dispensary

  • Grass Roots Store Menu features one the of the bay area’s largest selections of medical cannabis products
  • Find everything from fresh flowers, pre-rolls galore, premium vape cartridges, tasty …

Grassrootssf.com   DA: 16 PA: 12 MOZ Rank: 33

More Guides About The Login At Grassroots Cannabisgrassroots

  • Here are the featured and popular login help you can get at Grassroots Cannabisgrassroots-logograssroots-logograssroots-logo
  • You can be also given specific login instructions or …

Danke.iliensale.com   DA: 19 PA: 43 MOZ Rank: 68

Grassroots Cannabis LinkedIn

  • Grassroots Cannabis | 16,206 followers on LinkedIn
  • Serving The Movement | We’re Grassroots, a new cannabis company that’s all about living deeply
  • We started in Illinois and we’re growing

Linkedin.com   DA: 16 PA: 28 MOZ Rank: 51

Grassrootscannabisdispensary – Grassrootss Cannabis Dispensary

  • We offer $69 ounces, $109 ounces, $169 ounces and $229 ounces
  • grassrootscannabisdispensary ships United States-wide is secure and offers a satisfaction …

Grassrootscannabisdispensary.com   DA: 32 PA: 32 MOZ Rank: 72

Recently Analyzed

1: Grassrootscannabis.com 1 seconds ago

2: Ipltitle24.com 15 seconds ago

3: Huizelipin.com 43 seconds ago

4: Dementiafriendsny.org 3 seconds ago

5: Nasharch.com 12 seconds ago

6: Canikarms.com 13 seconds ago

7: Ae2soperations.com 1 seconds ago

8: Nimbusds.com 7 seconds ago

9: Muebles4.com 1 seconds ago

10: Playbestfreegame.com 3 seconds ago

Tool Checker

Domain Expiry Date Updated

Expiry DateExpiry DateDomain ProviderHosting Provider
Playbestfreegame.com 150 days leftOVH sasDomain Name Services
Muebles4.com 141 days leftArsys Internet, S.L. dba NICLINE.COMRIPE Network Coordination Centre
Nimbusds.com 194 days leftCloudFlare, Inc.Cloudflare, Inc.
Ae2soperations.com 358 days leftHong Kong Juming Network Technology Co., Ltd.Guizhou Dike Yundata Technology CO .,LTD.
Canikarms.com4 years, 325 days leftGoogle LLCDomain Name Services
Nasharch.com4 years, 272 days leftNetwork Solutions, LLCFastly
Dementiafriendsny.org 361 days leftFastDomain Inc.Unified Layer
Huizelipin.com 245 days leftDynadot11 LLCEGIHosting
Ipltitle24.com 219 days leftGoDaddy.com, LLCGoDaddy.com, LLC
Grassrootscannabis.com 331 days leftGoDaddy.com, LLCGoogle LLC

<< See All >>

.COM - 10,595,200+   .ORG - 1,117,549+   .EDU - 123,500+   .NET - 792,945+   .GOV - 30,232+   .US - 84,439+   .CA - 122,904+   .DE - 220,061+   .UK - 272,390+   .IT - 108,882+   .AU - 152,812+   .CO - 51,739+   .BIZ - 59,081+   .IO - 32,494+   .NL - 99,647+   .SG - 19,713+   .INFO - 81,589+   .IE - 26,934+   .ME - 25,076+   .FR - 98,576+   .EU - 61,372+   .RU - 165,043+   .PH - 9,511+   .INT - 1,166+   .IN - 87,021+   .ES - 38,035+   .CZ - 71,869+   .VN - 48,920+   .TV - 14,250+   .SITE - 9,829+   .RO - 37,484+   .PL - 44,520+   .PK - 10,373+   .MOBI - 4,464+   .LK - 5,507+   .CN - 66,137+   .CH - 66,914+   .AT - 31,992+  

Email Address Search | IP Address Blacklist Check | Hosting Providers | Domain Providers | Website Error Checker

© 2018 Site-Stats.org. All rights reserved. Email: [email protected]