International.schwab.com

International.schwab.com has server used 162.93.229.103 (United States) ping response time Hosted in Charles Schwab & Co., Inc. Register Domain Names at MarkMonitor Inc.. This domain has been created 28 years, 166 days ago, remaining 199 days. You can check the 1 Websites and blacklist ip address on this server

Domain information

Registrar WHOIS Server: whois.markmonitor.com

Registrar URL: http://www.markmonitor.com     See All 30,435+

Creation Date: 1993-04-07 28 years, 166 days

Updated Date: 2021-05-20 122 days ago

Expiry Date: 2022-04-08 199 days left     See All

  Sign up for notifications near expiration

Registrar: MarkMonitor Inc.

Abuse Email: [email protected]

Abuse Phone: +1.2083895740

  Full details

Top 10 Hosting Providers

Registrar URLDomain CountsRegistrar NameAbuse Email
www.godaddy.com2,280,668GoDaddy.com, LLC[email protected]
www.tucows.com535,579Tucows Domains Inc.
networksolutions.com526,027Network Solutions, LLC[email protected]
www.namecheap.com333,839NameCheap, Inc.[email protected]
www.enom.com299,925eNom, LLC
www.publicdomainregistry.com294,948PDR Ltd. d/b/a PublicDomainRegistry.com[email protected]
www.whois.godaddy.com174,077GoDaddy.com, LLC[email protected]
www.fastdomain.com161,753FastDomain Inc.[email protected]
www.ionos.com159,2071&1 IONOS SE[email protected]
www.networksolutions.com149,653Network Solutions, LLC[email protected]

Full view & Download

Keywords Suggestions

Schwab login

Schwab

Schwab client login

Schwab.com

Schwab alliance

Schwab advisor center

Schwabplan login

Schwab bank

Schwab institutional logon

Schwab workplace

Schwab login my account

Schwabplan

Schwab client login my account

Schwab institutional login

Schwab intelligent portfolios

Schwab institutional

Schwab 401k

Schwab's

Schwab retirement

Schwab ira

Schwab eac

Schwab jobs

Schwaba law

Schwab brokerage

Schwab screen share

( Please select at least 2 keywords )

See More:   A   B   C   D   E   F   G   H   I   J   K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z  

› Charles schwab log in to my accounts

› Charles schwab client center

› Charles schwab sign in

› Charles schwab customer service

› Https schwab corporate actions

› Schwab account online

› Schwab stock slices

› International charles schwab

Hosting Provider

NetName: SCHWAB2

Organization: Charles Schwab & Co., Inc.     See All 22+

Provider URL: Schwab.com

Hostname: schwab.com

IP Server: 162.93.229.103 Reg: 1992-09-25, Updated: 2014-07-10

Blacklist: Check Backlist Status

Country: United States

Address: 211 Main Street, San Francisco, CA 94105, US

Latitude: 37.789799

Longitude: -122.394203

Name Server:

  • A8-64.AKAM.NET
  • A9-65.AKAM.NET
  • NS1.SCHWAB.COM
  • NS2.SCHWAB.COM
  • NS3.SCHWAB.COM
  • NS4.SCHWAB.COM

Abuse Email: [email protected]

Abuse Phone: +1-877-977-5789

Top 10 Hosting Providers

Website URLDomain CountsOrganizationAbuse Email
Google.com681,421Google LLC[email protected]
Godaddy.com650,706GoDaddy.com, LLC[email protected]
Cloudflare.com637,900Cloudflare, Inc.[email protected]
Endurance.com488,827The Endurance International Group, Inc.[email protected]
Amazon.com439,891Amazon Technologies Inc.[email protected]
297,405Domain Name Services
Amazonaws.com287,121Amazon Technologies Inc.[email protected]
Liquidweb.com159,971Liquid Web, L.L.C[email protected]
Squarespace.com150,667Squarespace, Inc.[email protected]
Ripe.net128,362RIPE Network Coordination Centre[email protected]

Full view & Download

List of found email addresses

No Emails Found

Find Websites hosted

1: Schwab.com

At least 1 Sites on this server

Port Scanner (IP: 162.93.229.103)

Charles Schwab International Why Invest In The U.S. With

  • At Schwab International, we believe in putting investors first
  • We're here to help international investors get the most out of their U.S
  • is home to the world's largest financial market.*
  • Our financial consultants, tools, and …

International.schwab.com   DA: 24 PA: 24 MOZ Rank: 48

Help For Your U.S. Investments

  • Email Write to us Mailing address Send applications, deposits, and other materials to: Charles Schwab & Co., Inc
  • Attn: International Operations 1945 Northwestern Drive El Paso, TX 79912-1108, USA
  • Options carry a high level of risk and are not suitable for all investors
  • Certain requirements must be met to trade options through Schwab.

International.schwab.com   DA: 24 PA: 20 MOZ Rank: 45

International Toll Free Numbers Charles Schwab

  • If the country from which you are calling does not appear in the list above, please call 317-596-4501 to be connected with a Schwab representative.

Schwab.com   DA: 14 PA: 43 MOZ Rank: 59

Contact Us Charles Schwab

  • Call 888-245-6864 to request access (a Schwab brokerage account is required)
  • Schwab reserves the right to restrict or modify access at any time
  • Schwab Intelligent Portfolios is made available through Charles Schwab & Co., Inc
  • ("Schwab") a dually-registered investment adviser and broker dealer.

Schwab.com   DA: 14 PA: 11 MOZ Rank: 28

Open An Account Intro

  • Mailing Service Alert: Schwab currently mails statements, trade confirmations and other account-related material from the United States
  • Due to the evolving situation of the pandemic, the US Postal Service is unable to deliver mail to a number of international jurisdictions
  • Please visit USPS.com for updates.

International.schwab.com   DA: 24 PA: 19 MOZ Rank: 47

Charles Schwab-TD Ameritrade Acquisition International

  • If you are an international client calling from outside the U.S., please call +1-415-667-8400 5:30 p.m
  • If you are calling from inside the U.S., please call +877-686-1937.

Welcome.schwab.com   DA: 18 PA: 14 MOZ Rank: 37

Global Investing International Investing Charles Schwab

  • Equity trading in over 30 foreign markets
  • Research from Schwab and third-party experts
  • Trade in 7 local currencies in 12 foreign markets via the Schwab Global Account™
  • Speak with a Global Investing Services specialist anytime between 5:30 p.m

Schwab.com   DA: 14 PA: 17 MOZ Rank: 37

Login Charles Schwab

  • The Charles Schwab Corporation provides a full range of brokerage, banking and financial advisory services through its operating subsidiaries
  • Its broker-dealer subsidiary, Charles Schwab & Co., Inc
  • ( member SIPC ), offers investment services and products, including Schwab brokerage accounts.

Client.schwab.com   DA: 17 PA: 38 MOZ Rank: 62

Contact Charles Schwab Customer Service

  • Contact Charles Schwab customer support at toll-free or accesibility phone number
  • Call or write an email to resolve Charles Schwab issues: Account, Request for Information, Employment
  • Visit the company website www.schwab.com or live chat for more information.

Charles-schwab.pissedconsumer.com   DA: 33 PA: 22 MOZ Rank: 63

Expatriate Essentials

  • There are no fees to use Schwab Trading Services
  • Other accounts fees, optional data fees, fund expenses and transaction charges may apply
  • Schwab reserves the right to restrict or modify access at any time
  • For questions, contact us to speak with a Schwab representative
  • Schwab's StreetSmart Edge is available for Schwab Trading Services clients.

International.schwab.com   DA: 24 PA: 22 MOZ Rank: 55

Contact Us Charles Schwab

  • market with an account designed specifically for international investors
  • If your needs allow for it, we encourage you to use Schwab website and the mobile app
  • If you plan to visit please contact our office
  • Call New customers +852-2101-0511 Monday-Friday, 9:00 am to 6:00 pm (HK Time)

Schwab.com.hk   DA: 17 PA: 11 MOZ Rank: 38

Charles Schwab A Modern Approach To Investing & Retirement

  • The Schwab One brokerage account has no minimum balance requirements, minimum balance charges, minimum trade requirements, and there is no requirement to fund this account, when opened with a linked High Yield Investor Checking account
  • To learn more about other Schwab Bank checking accounts, please contact Schwab Bank at 888-403-9000

Schwab.com   DA: 14 PA: 14 MOZ Rank: 39

International Schwab Equity Awards Center

  • To talk to a Schwab Stock Plan Specialist, call 800-654-2593
  • International participants, call +1-602-355-3408
  • Narrator: Or, from your Schwab account, navigate to Equity Awards and click on Knowledge Center
  • Onscreen text: Or from your Schwab account, navigate to Equity Awards and click on Knowledge Center
  • The Charles Schwab logo appears.

Eac.schwab.com   DA: 14 PA: 19 MOZ Rank: 45

Schwab International Client Schwab Int’l Information

  • Return the form(s) to Schwab International Operations, P.O
  • Box 982601, El Paso, TX 79998-2601, USA, or send by overnight delivery to Schwab International Operations, 1945 Northwestern Drive, El Paso, TX 79912-1108, USA
  • You may also fax the completed form to +1-415-956-3212 or email it
  • using the secure email feature on the Schwab website.

Client.schwab.com   DA: 17 PA: 50 MOZ Rank: 80

International Returns By Country Charles Schwab

  • The Charles Schwab Corporation provides a full range of brokerage, banking and financial advisory services through its operating subsidiaries
  • Its broker-dealer subsidiary, Charles Schwab & Co., Inc
  • ( Member SIPC ), offers investment services and products, including Schwab brokerage accounts.

Schwab.com   DA: 14 PA: 42 MOZ Rank: 70

Verify Your Request For A Foreign Wire

  • Schwab charges a markup on foreign currency exchange transactions
  • Current exchange rates and selected currency pairs will affect the markup charged
  • Please contact Schwab if you have any questions about currency exchange transactions at 1-800-362-1774 or +1-602-355-5380
  • • Please note: Accuracy is important.

Client.schwab.com   DA: 17 PA: 50 MOZ Rank: 82

Contact Us Workplace Financial Services

  • Schwab Retirement Plan Services, Inc., provides recordkeeping and related services with respect to retirement plans
  • Schwab Stock Plan Services is a division of Charles Schwab & Co., Inc
  • providing equity compensation plan services and brokerage solutions for corporate clients.

Workplacefinancialservices.schwab.com   DA: 37 PA: 8 MOZ Rank: 61

Process By Update Your Schwab One Account International

  • Add checks and debit cards to your existing Schwab One International Account
  • Add an additional account holder
  • Submit your completed form to Schwab International Account Solutions, P.O
  • Box 982601, El Paso, TX 79998-2601.

Client.schwab.com   DA: 17 PA: 50 MOZ Rank: 84

Klaus Schwab World Economic Forum

  • Professor Klaus Schwab was born in Ravensburg, Germany in 1938
  • He is Founder and Executive Chairman of the World Economic Forum, the International Organization for Public-Private Cooperation
  • This site uses cookies to deliver website functionality and analytics.

Weforum.org   DA: 15 PA: 19 MOZ Rank: 52

Charles Schwab International Account

  • On 7/14/2021 at 1:31 AM, higgy88 said: I've had a Schwab brokerage account for probably close to 40 years
  • About 10 years ago, I no longer had a US address I felt comfortable using, so I gave Schwab my Thai address and they said I had to open an international account, so I did
  • In a nutshell, I find Schwab international a PITA to deal with.

Aseannow.com   DA: 12 PA: 50 MOZ Rank: 81

Charles Schwab Client Center

  • If you cannot provide both, or do not believe your email is secure, call 800-780-2755
  • (0914-6168) Charles Schwab & Co., Inc
  • and Charles Schwab Bank, SSB are separate but affiliated companies and wholly-owned subsidiaries of The Charles Schwab Corporation
  • Brokerage products and services are offered by Charles

Client.schwab.com   DA: 17 PA: 50 MOZ Rank: 87

How To Contact Charles Schwab Bank

  • The numbers operate 24 hours a day unless otherwise stated
  • If you are still struggling to receive the answers you need, then remember FairShake can help can help you resolve the issue you have with Charles Schwab Bank
  • Charles Schwab 24/7 support: 800-435-4000

Fairshake.com   DA: 13 PA: 41 MOZ Rank: 75

Schwab Alliance Advisor Services

  • Schwab Alliance is a version of the schwab.com website customized specifically for clients of advisors
  • You can customize it with your firm's branding, choose the information your clients see, and more
  • Most importantly, Schwab Alliance is the key to empowering your clients to electronically approve everything from new accounts to move money

Advisorservices.schwab.com   DA: 26 PA: 50 MOZ Rank: 98

Finance, Service, Engineering, & Developer Jobs Schwab Jobs

  • Schwab is committed to building a diverse and inclusive workplace where everyone feels valued
  • As an equal employment opportunity employer, our policy is to provide equal employment opportunities to all employees and applicants without regard to any status that is protected by law (Equal Employment Opportunity policy).Schwab is also an affirmative action employer, focused on advancing women

Jobs.schwabjobs.com   DA: 19 PA: 19 MOZ Rank: 61

Schwab International Advisor Services

  • LinkedIn and RIA Channel are not affiliated with Charles Schwab and Co., Inc
  • RIA Channel will share your information with Sponsor, Charles Schwab & Co., Inc
  • Schwab may use it to contact you and to send you additional insights from Schwab Advisor Services™.

Advisorservices.schwab.com   DA: 26 PA: 19 MOZ Rank: 69

Contact Us Schwaab, Inc

  • Brookfield, WI 53005 Tel: 800-935-9877 Email: [email protected] Fax: 800-935-9866
  • With over 130 years of experience working with businesses in every industry, we've acquired unique industry knowledge you won't find anywhere else
  • Whether you have a special marking need or need a way to reward

Schwaab.com   DA: 15 PA: 17 MOZ Rank: 57

Giving Internationally

  • Schwab Charitable Fund™ is recognized as a tax-exempt public charity as described in Sections 501(c)(3), 509(a)(1), and 170(b)(1)(A)(vi) of the Internal Revenue Code
  • Contributions made to Schwab Charitable Fund™ are considered an irrevocable gift and are not refundable.

Schwabcharitable.org   DA: 24 PA: 37 MOZ Rank: 87

Summary Of Agreements For Schwab One International No I At

  • CC530479 0619-95RZ) APP107121DI-01 06/21) *APP107121DI-01=01* • Affirm that you have received and read the Account Agreement and understand that it is a legally binding agreement the equivalent of a written

Client.schwab.com   DA: 17 PA: 50 MOZ Rank: 94

Contact Us Charles Schwab Singapore

  • Customer service hours: 5:30 p.m
  • Saturday (US ET) Thank you for contacting Schwab
  • We’ll respond to you by email or phone within approximately 48 hours
  • If you'd like to speak with a Schwab investment representative immediately, please call …

Schwab.com.sg   DA: 17 PA: 32 MOZ Rank: 77

Charles Schwab Corporation Careers Center Welcome

Charles Schwab Corporation | Careers Center | Welcome

Career-schwab.icims.com   DA: 23 PA: 12 MOZ Rank: 64

Recently Analyzed

1: Hceng.com 2 seconds ago

2: Nocoto.com 4 seconds ago

3: Ntplpower.com 2 seconds ago

4: Clouddoi8.com 0 seconds ago

5: Seafoodsteakoystersdothan.com 0 seconds ago

6: Peitu223.com 6 seconds ago

7: Wipexchina.com 4 seconds ago

8: Auburnart.com 2 seconds ago

9: Freebookkeepingaccounting.com 0 seconds ago

10: Primeseamless.com 1 seconds ago

Tool Checker

Domain Expiry Date Updated

Expiry DateExpiry DateDomain ProviderHosting Provider
Primeseamless.com 87 days leftGoDaddy.com, LLCSteadfast
Freebookkeepingaccounting.com2 years, 123 days leftNetwork Solutions, LLCDomain Name Services
Auburnart.com1 year, 23 days leftDomainSpot LLCShopify, Inc.
Wipexchina.com1 year, 54 days leftAlibaba Cloud Computing (Beijing) Co., Ltd.Cloudflare, Inc.
Peitu223.com 237 days leftALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITEDCloudRadium L.L.C
Seafoodsteakoystersdothan.com 203 days leftRegister.com, Inc.Amazon Technologies Inc.
Clouddoi8.com 331 days leftGoDaddy.com, LLCGoogle LLC
Ntplpower.com1 year, 105 days leftPDR Ltd. d/b/a PublicDomainRegistry.comRailwire Amritsar
Nocoto.com6 years, 358 days leftGMO Internet, Inc. d/b/a Onamae.comAmazon Technologies Inc.
Hceng.com1 year, 70 days leftRegister.com, Inc.Amazon Technologies Inc.

<< See All >>

.COM - 10,595,200+   .ORG - 1,117,549+   .EDU - 123,500+   .NET - 792,945+   .GOV - 30,232+   .US - 84,439+   .CA - 122,904+   .DE - 220,061+   .UK - 272,390+   .IT - 108,882+   .AU - 152,812+   .CO - 51,739+   .BIZ - 59,081+   .IO - 32,494+   .NL - 99,647+   .SG - 19,713+   .INFO - 81,589+   .IE - 26,934+   .ME - 25,076+   .FR - 98,576+   .EU - 61,372+   .RU - 165,043+   .PH - 9,511+   .INT - 1,166+   .IN - 87,021+   .ES - 38,035+   .CZ - 71,869+   .VN - 48,920+   .TV - 14,250+   .SITE - 9,829+   .RO - 37,484+   .PL - 44,520+   .PK - 10,373+   .MOBI - 4,464+   .LK - 5,507+   .CN - 66,137+   .CH - 66,914+   .AT - 31,992+  

Email Address Search | IP Address Blacklist Check | Hosting Providers | Domain Providers | Website Error Checker

© 2018 Site-Stats.org. All rights reserved. Email: [email protected]