Perkinswill.com

Perkinswill.com has server used 141.193.213.20 (Spain) ping response time Hosted in WPEngine, Inc. Register Domain Names at Network Solutions, LLC. This domain has been created 24 years, 292 days ago, remaining 9 years, 71 days. You can check the 18 Websites and blacklist ip address on this server

Domain information

Registrar WHOIS Server: whois.networksolutions.com

Registrar URL: http://networksolutions.com     See All 526,027+

Creation Date: 1997-01-07 24 years, 292 days

Updated Date: 2021-01-06 293 days ago

Expiry Date: 2031-01-06 9 years, 71 days left     See All

  Sign up for notifications near expiration

Registrar: Network Solutions, LLC

Abuse Email: [email protected]

Abuse Phone: +1.8003337680

  Full details

Top 10 Hosting Providers

Registrar URLDomain CountsRegistrar NameAbuse Email
www.godaddy.com2,280,668GoDaddy.com, LLC[email protected]
www.tucows.com535,579Tucows Domains Inc.
networksolutions.com526,027Network Solutions, LLC[email protected]
www.namecheap.com333,839NameCheap, Inc.[email protected]
www.enom.com299,925eNom, LLC
www.publicdomainregistry.com294,948PDR Ltd. d/b/a PublicDomainRegistry.com[email protected]
www.whois.godaddy.com174,077GoDaddy.com, LLC[email protected]
www.fastdomain.com161,753FastDomain Inc.[email protected]
www.ionos.com159,2071&1 IONOS SE[email protected]
www.networksolutions.com149,653Network Solutions, LLC[email protected]

Full view & Download

Keywords Suggestions

Perkinswill.com

Perkins willmar mn

Perkins willmar

Perkins wills

Perkins william

Perkins williamson

Perkins willmar menu

Perkins will dar

Perkins will nyc

Perkins will jobs

Perkins will rush

Perkins will arch

Perkins will china

Perkins will austin

Perkins will boston

Perkins will denver

Perkins will miami

Perkins will alabama

Perkins will career

Perkins will chicago

Perkins willmar mn hours

Perkins will and c2c

( Please select at least 2 keywords )

See More:   A   B   C   D   E   F   G   H   I   J   K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z  

› Perkins will office locations

› Perkins will seattle

› Perkins will dc

› Perkins will dallas

› Perkins will arch

› Perkins will chicago

› Perkins will boston

› Perkins will architecture

Hosting Provider

NetName: WPENG

Organization: WPEngine, Inc.     See All 471+

Provider URL: Wpengine.com

Hostname: 141.193.213.20

IP Server: 141.193.213.20 Reg: 2020-07-13, Updated: 2020-07-23

Blacklist: Check Backlist Status

Country: Spain

Address: 504 Lavaca Street, Austin, TX 78701, US

Latitude: 40.416500

Longitude: -3.702600

Name Server:

  • NS0.DNSMADEEASY.COM
  • NS1.DNSMADEEASY.COM
  • NS2.DNSMADEEASY.COM
  • NS3.DNSMADEEASY.COM
  • NS4.DNSMADEEASY.COM

Abuse Email: [email protected]

Abuse Phone: +1-877-973-6446

Top 10 Hosting Providers

Website URLDomain CountsOrganizationAbuse Email
Google.com681,421Google LLC[email protected]
Godaddy.com650,706GoDaddy.com, LLCabuse[email protected]
Cloudflare.com637,900Cloudflare, Inc.[email protected]
Endurance.com488,827The Endurance International Group, Inc.[email protected]
Amazon.com439,891Amazon Technologies Inc.[email protected]
297,405Domain Name Services
Amazonaws.com287,121Amazon Technologies Inc.[email protected]
Liquidweb.com159,971Liquid Web, L.L.C[email protected]
Squarespace.com150,667Squarespace, Inc.[email protected]
Ripe.net128,362RIPE Network Coordination Centre[email protected]

Full view & Download

List of found email addresses

  1: [email protected]

  2: [email protected]

Find Websites hosted

1: Lslbc.louisiana.gov

2: Arlspublic.lslbc.louisiana.gov Changed to: 98.185.5.103

3: Schoolcraft.edu

4: Bb.schoolcraft.edu Changed to: 216.55.113.99

5: My.schoolcraft.edu Changed to: 216.55.113.179

6: Catalog.schoolcraft.edu Changed to: 18.215.95.201

7: Home.schoolcraft.edu Changed to: 216.55.113.80

8: Ncacpa.org Changed to: 35.185.6.42

9: Sonimtech.com Changed to: 35.233.186.82

10: Technobezz.com Changed to: 172.67.70.77

11: Home.bt.com Changed to: 68.142.68.29

12: Whatismyip.com Changed to: 104.27.194.88

13: Givedirectly.org Changed to: 13.227.138.31

14: Onyxinsight.com Changed to: 141.193.213.21

15: Bfm.sbc.net

16: Freespeech.org

17: Govenda.com Changed to: 141.193.213.21

18: Millersalehouse.com

At least 18 Sites on this server

Port Scanner (IP: 141.193.213.20)

User Login Perkins And Will Research

  • This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply
  • ©2021: Perkins and Will Research

Research.perkinswill.com   DA: 24 PA: 12 MOZ Rank: 36

Perkins&Will

  • Five years ago, we celebrated the National Museum of African American History and Culture’s grand opening
  • Now, we look back on its architectural staying power and how it’s a harbinger for positive social change
  • In an exclusive new video produced by The American Institute of Architects, Gabrielle

Perkinswill.com   DA: 15 PA: 15 MOZ Rank: 31

Newforma Info Exchange

  • Sign in to Newforma Info Exchange

Nix.perkinswill.com   DA: 19 PA: 25 MOZ Rank: 46

Engage.perkinswill.com

  • Can’t access your account? Terms of use Privacy & cookies Privacy & cookies

Engage.perkinswill.com   DA: 22 PA: 22 MOZ Rank: 47

Perkins Perkins Restaurant & Bakery

  • Perkins Restaurant & Bakery
  • In 1958, a humble pancake house was born
  • Through the years, we've stayed true to our breakfast roots while welcoming American classics and homestyle plates.

Perkinsrestaurants.com   DA: 26 PA: 26 MOZ Rank: 56

Become A MyPerkins EClub

  • A Classic Cheeseburger, some fries, and your favorite slice of Cherr y Pie, now that’s a combo you’ll be telling your grandkids about

Facebook.com   DA: 16 PA: 35 MOZ Rank: 56

Log In Workplace Financial Services

  • Schwab Compliance Technologies®
  • Log in here to manage your Schwab Compliance Technologies software platform and access resources and tools to help with day-to-day administration
  • Log In to Schwab Compliance Technologies
  • Talk with us about all the options available to your business.

Workplacefinancialservices.schwab.com   DA: 37 PA: 6 MOZ Rank: 49

Customer Login Perkins

  • Customer Machine Engineering Team
  • Perkins CMET works in close collaboration with original equipment manufacturers’ (OEMs).

Perkins.com   DA: 15 PA: 26 MOZ Rank: 48

Projects – Perkins&Will

  • Schulze Family Foundation American Cancer Society, Hope Lodge

Perkinswill.com   DA: 15 PA: 6 MOZ Rank: 29

Studios – Perkins&Will

  • With studio cultures unique to their place and people, we’re the smallest “big firm” out there.

Perkinswill.com   DA: 15 PA: 9 MOZ Rank: 33

Careers – Perkins&Will

  • Follow @perkinswill Behind the Scenes
  • Our Talent Exchange program gives designers the chance to experience other cultures by working in different studios around the world
  • Gender equity and the #MeToo movement are important to us
  • Our Gender Equity Taskforce in Toronto recently co-hosted a panel featuring female trailblazers in design.

Perkinswill.com   DA: 15 PA: 9 MOZ Rank: 34

Our Purpose – Perkins&Will

  • Our work enlivens neighborhoods, builds communities, energizes the citizenry, and respects and protects our planet
  • Several ideals ignite our passions and keep us focused on what matters
  • These core values are the building blocks of who …

Perkinswill.com   DA: 15 PA: 13 MOZ Rank: 39

Perkins+Will Email Format Perkinswill.com Emails

  • Perkins+Will uses 1 email formats, with first '.' last (ex
  • [email protected]) being used 100.0% of the time
  • Get Verified Emails for Perkins+Will Employees

Rocketreach.co   DA: 14 PA: 43 MOZ Rank: 69

Sign In To Issuu Easy-To-Use Content & Distribution Tools

All-in-one content creation & distribution platform to convert content into high-quality visuals and multiple formats to distribute on the web, social and more.

Issuu.com   DA: 9 PA: 7 MOZ Rank: 29

Unbeatable Range Of Power Solutions Perkins

  • You can always depend on Perkins engines, Perkins motors and Perkins diesel wherever you are.

Perkins.com   DA: 15 PA: 11 MOZ Rank: 40

Perkins And Will Company Profile

  • Perkins and Will is a company providing architecture and design services
  • It offers solutions such fields as interior design, branded environments, urban design, landscape architecture, sports, recreation, entertainment, and more.

Craft.co   DA: 8 PA: 17 MOZ Rank: 40

Perkins&Will Ontario Is On Instagram • 244 Posts On

  • Interdisciplinary studios using the power of design to transform places in which people live, learn, work, and play
  • OTT — 275 Slater linkin.bio/perkinswill…

Instagram.com   DA: 17 PA: 17 MOZ Rank: 50

Perkins+Will Email Format Perkins+Will.com Emails

  • Email formats, Phone Number, CEO CTO CFO COO CMO email of Perkins+Will
  • Location: Office No.1004 to 1006, 10th Floor, Marina Plaza, Al Quoz Industrial Area 3 - Dubai - United Arab Emirates

Aeroleads.com   DA: 13 PA: 34 MOZ Rank: 64

Perkins+Will VentureRadar

  • "Established in 1935, Perkins+Will is an integrated design firm practicing architecture, interiors, branded environments, planning + strategies and urban design
  • With more LEED Accredited Professionals than any firm in the world, Perkins+Will is recognized as a preeminent sustainable design firm in the country."

Ventureradar.com   DA: 20 PA: 50 MOZ Rank: 88

Perkins And Will

  • Perkins and Will, an interdisciplinary, research-based architecture and design firm, was founded in 1935 on the belief that design has the power to transform lives
  • Guided by its core values—design excellence, diversity and inclusion, research, resilience, social purpose, sustainability, and well-being—the firm is committed to designing a better, more beautiful

Officelovin.com   DA: 19 PA: 23 MOZ Rank: 61

Perkins+Will Email Format Perkinswill.com Emails

  • Perkins+Will uses 1 email formats, with first '.' last (ex
  • [email protected]) being used 100.0% of the time
  • Get Verified Emails for Perkins+Will Employees

Rocketreach.co   DA: 14 PA: 42 MOZ Rank: 76

Perkins And Will

  • Global architecture and design firm with offices in Durham and Charlotte.

Facebook.com   DA: 16 PA: 15 MOZ Rank: 52

Perkins&Will

  • 19,168 likes · 35 talking about this
  • Collaborating with clients all over the world to create healthy, sustainable places to live, learn, work, play, and heal

Facebook.com   DA: 16 PA: 18 MOZ Rank: 56

Products Perkins

  • For over 85 years, Perkins has led the field in the design and manufacture of high-performance diesel engines
  • With an engine range from .5 to 36 litres, Perkins engines power more than five thousand different applications throughout the world
  • And that's all thanks to our global network of manufacturing facilities that follow the

Perkins.com   DA: 15 PA: 20 MOZ Rank: 58

Perkins School For The Blind

  • We are the worldwide leader in education services for children and young adults who are blind and visually impaired with multiple disabilities
  • An international NGO, we are infinitely innovating to solve longstanding and emerging problems facing our communities, our students and our families

Perkins.org   DA: 15 PA: 15 MOZ Rank: 54

Nslookup Microsoft Docs

  • For the first parameter, type the name or IP address of the computer that you want to look up
  • For the second parameter, type the name or IP address of a DNS name server
  • If you omit the second argument, nslookup uses the default DNS name server
  • If you need to look up more than one piece of data, you can use interactive mode.

Docs.microsoft.com   DA: 18 PA: 50 MOZ Rank: 93

Carbon Span Perkins And Will Research

  • We developed a Carbon-Span Calculator to compare these impacts alongside one another, and to assess interventions to achieve carbon neutrality
  • Balancing carbon requires reduction, substitution, and sequestration
  • Each of these measures offers low-hanging fruit that can be applied to most projects with clear impact.

Research.perkinswill.com   DA: 24 PA: 22 MOZ Rank: 72

Perkins&Will LinkedIn

  • Perkins&Will | 189,889 followers on LinkedIn
  • Collaborating with clients all over the world to create healthy, sustainable places to live, learn, work, play, and heal | Since 1935, we’ve believed that design has the power to make the world a better, more beautiful place
  • That’s why clients and community members on nearly every continent partner with us to design healthy, happy places in

Ca.linkedin.com   DA: 15 PA: 21 MOZ Rank: 63

Perkins+Will: Most Innovative Company Fast Company

  • Perkins+Will is one of the largest architecture firms in the world, with 24 global offices and 2,000 employees
  • Its buildings include the National Museum of African American History

Fastcompany.com   DA: 19 PA: 20 MOZ Rank: 67

Industrial Perkins

  • Perkins power solutions are designed to improve your performance and productivity
  • We have poured our passion, innovation and engineering excellence into manufacturing more than 21 million engines - 5 million of which are are still powering the world, and our customers, today.

Perkins.com   DA: 15 PA: 43 MOZ Rank: 87

Recently Analyzed

1: Pissedconsumer.com 1 seconds ago

2: Lelandco.com 2 seconds ago

3: Ihelper.com 2 seconds ago

4: Elerateknik.com 0 seconds ago

5: Softnslosquishies.com 4 seconds ago

6: Herbaldispatch.com 5 seconds ago

7: Spotonapparel.com 2 seconds ago

8: Topstoffen.com 4 seconds ago

9: Perkinswill.com 1 seconds ago

10: Nssiti.com 2 seconds ago

Tool Checker

Domain Expiry Date Updated

Expiry DateExpiry DateDomain ProviderHosting Provider
Nssiti.com 264 days leftGoDaddy.com, LLCDomain Name Services
Perkinswill.com9 years, 71 days leftNetwork Solutions, LLCWPEngine, Inc.
Topstoffen.com 163 days leftMetaregistrar BVCloudflare, Inc.
Spotonapparel.com 139 days leftBigRock Solutions LtdUnified Layer
Herbaldispatch.com 83 days leftGoDaddy.com, LLCCloudflare, Inc.
Softnslosquishies.com 191 days leftWild West Domains, LLCCloudflare, Inc.
Elerateknik.com 43 days leftNics Telekomunikasyon A.S.Domain Name Services
Ihelper.com 232 days leftNetwork Solutions, LLCConfluence Networks Inc
Lelandco.com3 years, 351 days leftNetwork Solutions, LLCWeb.com, Inc.
Pissedconsumer.com 10 days leftGoDaddy.com, LLCAmazon Technologies Inc.

<< See All >>

.COM - 10,595,200+   .ORG - 1,117,549+   .EDU - 123,500+   .NET - 792,945+   .GOV - 30,232+   .US - 84,439+   .CA - 122,904+   .DE - 220,061+   .UK - 272,390+   .IT - 108,882+   .AU - 152,812+   .CO - 51,739+   .BIZ - 59,081+   .IO - 32,494+   .NL - 99,647+   .SG - 19,713+   .INFO - 81,589+   .IE - 26,934+   .ME - 25,076+   .FR - 98,576+   .EU - 61,372+   .RU - 165,043+   .PH - 9,511+   .INT - 1,166+   .IN - 87,021+   .ES - 38,035+   .CZ - 71,869+   .VN - 48,920+   .TV - 14,250+   .SITE - 9,829+   .RO - 37,484+   .PL - 44,520+   .PK - 10,373+   .MOBI - 4,464+   .LK - 5,507+   .CN - 66,137+   .CH - 66,914+   .AT - 31,992+  

Email Address Search | IP Address Blacklist Check | Hosting Providers | Domain Providers | Website Error Checker

© 2018 Site-Stats.org. All rights reserved. Email: [email protected]