Sccchwab.com

Sccchwab.com has server used 104.252.127.22 (United States) ping response time Hosted in EGIHosting Register Domain Names at Dynadot15 LLC. This domain has been created 122 days ago, remaining 242 days. You can check the 0 Website and blacklist ip address on this server

Domain information

Registrar WHOIS Server: whois.dynadot15.com

Registrar URL: http://www.dynadot15.com     See All 201+

Creation Date: 2022-06-04 122 days

Updated Date: 2022-06-04 122 days ago

Expiry Date: 2023-06-04 242 days left     See All

  Sign up for notifications near expiration

Registrar: Dynadot15 LLC

Abuse Email: n/a

Abuse Phone: n/a

  Full details

Top 10 Hosting Providers

Registrar URLDomain CountsRegistrar NameAbuse Email
www.godaddy.com2,280,668GoDaddy.com, LLC[email protected]
www.tucows.com535,579Tucows Domains Inc.
networksolutions.com526,027Network Solutions, LLC[email protected]
www.namecheap.com333,839NameCheap, Inc.[email protected]
www.enom.com299,925eNom, LLC
www.publicdomainregistry.com294,948PDR Ltd. d/b/a PublicDomainRegistry.com[email protected]
www.whois.godaddy.com174,077GoDaddy.com, LLC[email protected]
www.fastdomain.com161,753FastDomain Inc.[email protected]
www.ionos.com159,2071&1 IONOS SE[email protected]
www.networksolutions.com149,653Network Solutions, LLC[email protected]

Full view & Download

Keywords Suggestions

Schwab login

Schwab

Schwabplan

Schwab.com

Schwabo

Schwab client login

Schwab login my account

Schwabisch gmund news

Schwab workplace

Schwab advisor center

Schwab login for clients

Schwab client login my account

Schwab institutional login

Schwab advisor login

Schwabach

( Please select at least 2 keywords )

See More:   A   B   C   D   E   F   G   H   I   J   K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z  

› Charles schwab log in account positions

› Log in to charles schwab account

› Charles schwab brokerage account minimum

› Charles schwab official site usa

› International banks charles schwab

› Schwab charles

› Schwab workplace

› Schwab alliance

Hosting Provider

NetName: EGN-21

Organization: EGIHosting     See All 13,205+

Provider URL: Egihosting.com

Hostname: 104.252.127.22

IP Server: 104.252.127.22 Reg: 2014-12-05, Updated: 2014-12-05

Blacklist: Check Backlist Status

Country: United States

Address: 3223 Kenneth Street, Santa Clara, CA 95054, US

Latitude: 37.338699

Longitude: -121.891403

Name Server:

  • NS1.GNAME-DNS.COM
  • NS2.GNAME-DNS.COM

Abuse Email: [email protected]

Abuse Phone: +1-888-808-8806

Top 10 Hosting Providers

Website URLDomain CountsOrganizationAbuse Email
Google.com681,421Google LLC[email protected]
Godaddy.com650,706GoDaddy.com, LLC[email protected]
Cloudflare.com637,900Cloudflare, Inc.[email protected]
Endurance.com488,827The Endurance International Group, Inc.[email protected]
Amazon.com439,891Amazon Technologies Inc.[email protected]
297,405Domain Name Services
Amazonaws.com287,121Amazon Technologies Inc.[email protected]
Liquidweb.com159,971Liquid Web, L.L.C[email protected]
Squarespace.com150,667Squarespace, Inc.[email protected]
Ripe.net128,362RIPE Network Coordination Centre[email protected]

Full view & Download

List of found email addresses

No Emails Found

Find Websites hosted

There are no results for IP: 104.252.127.22

Port Scanner (IP: 104.252.127.22)

Login Charles Schwab

  • The Charles Schwab Corporation provides a full range of brokerage, banking and financial advisory services through its operating subsidiaries
  • Its broker-dealer subsidiary, Charles …

Client.schwab.com   DA: 17 PA: 38 MOZ Rank: 55

All Accounts Charles Schwab

The Schwab One brokerage account has no minimum balance requirements, minimum balance charges, minimum trade requirements, and there is no requirement to fund this account, when …

Schwab.com   DA: 14 PA: 9 MOZ Rank: 24

Charles Schwab And Co., Inc Log In

  • Select Start Page Charles Schwab & Co., Inc
  • and Charles Schwab Bank, SSB, are separate but affiliated companies and wholly-owned subsidiaries of The …

Sws-gateway.schwab.com   DA: 22 PA: 16 MOZ Rank: 40

Login: Plan Participants: Schwab Retirement Plan Center

Call us:800-724-7526 Manage your contributions & investments877-285-4929 Set up an advice consultation800-750-0750 TTY.

Content.schwabplan.com   DA: 22 PA: 42 MOZ Rank: 67

Schwab Brokerage

  • This version of StreetSmart Edge is no longer supported
  • Click here to install the latest version of StreetSmart Edge Click here to run StreetSmart Edge in the cloud

Login.schwab.com   DA: 16 PA: 16 MOZ Rank: 36

Log In Workplace Financial Services

Through its operating subsidiaries, The Charles Schwab Corporation ("Charles Schwab") provides a full range of securities brokerage, banking, money management, and financial …

Workplacefinancialservices.schwab.com   DA: 37 PA: 15 MOZ Rank: 57

Charles Schwab International Invest In The U.S. Market With Schwab

  • There are multiple ways to fund your new Schwab account: Electronic funds transfer (EFT) with Schwab MoneyLink ® to transfer funds or assets from an external account

International.schwab.com   DA: 24 PA: 24 MOZ Rank: 54

Recently Analyzed

1: Ginnstech.com 1 mins ago

2: Sccchwab.com 1 seconds ago

3: Open-web.info 17 seconds ago

4: Muellerm.net 1 seconds ago

5: Aj-partyrentals.com 8 seconds ago

6: Yuweilong.com 6 seconds ago

7: Guaranteedremovals.com 15 seconds ago

8: Adcardz.com 2 seconds ago

9: Albendazoletablets.com 41 seconds ago

10: Cnhindustrialcapital.com 4 seconds ago

Tool Checker

Domain Expiry Date Updated

Expiry DateExpiry DateDomain ProviderHosting Provider
Cnhindustrialcapital.com1 year, 206 days leftCSC Corporate Domains, Inc.Microsoft Corporation
Albendazoletablets.com 142 days leftNetwork Solutions, LLCBodis, LLC
Adcardz.com 28 days leftWild West Domains, LLCCloudflare, Inc.
Guaranteedremovals.com 34 days leftGoDaddy.com, LLCCloudflare, Inc.
Yuweilong.com 133 days leftTurnCommerce, Inc. DBA NameBright.comAfrican Network Information Center
Aj-partyrentals.com1 year, 269 days leftGoDaddy.com, LLCGoDaddy.com, LLC
Muellerm.net 105 days leftCronon AGDomain Name Services
Open-web.info 102 days lefteNom, LLCDigitalOcean, LLC
Sccchwab.com 242 days leftDynadot15 LLCEGIHosting
Ginnstech.com 134 days leftTurnCommerce, Inc. DBA NameBright.comAfrican Network Information Center

<< See All >>

.COM - 10,595,200+   .ORG - 1,117,549+   .EDU - 123,500+   .NET - 792,945+   .GOV - 30,232+   .US - 84,439+   .CA - 122,904+   .DE - 220,061+   .UK - 272,390+   .IT - 108,882+   .AU - 152,812+   .CO - 51,739+   .BIZ - 59,081+   .IO - 32,494+   .NL - 99,647+   .SG - 19,713+   .INFO - 81,589+   .IE - 26,934+   .ME - 25,076+   .FR - 98,576+   .EU - 61,372+   .RU - 165,043+   .PH - 9,511+   .INT - 1,166+   .IN - 87,021+   .ES - 38,035+   .CZ - 71,869+   .VN - 48,920+   .TV - 14,250+   .SITE - 9,829+   .RO - 37,484+   .PL - 44,520+   .PK - 10,373+   .MOBI - 4,464+   .LK - 5,507+   .CN - 66,137+   .CH - 66,914+   .AT - 31,992+  

Email Address Search | IP Address Blacklist Check | Hosting Providers | Domain Providers | Website Error Checker

© 2018 Site-Stats.org. All rights reserved. Email: [email protected]