Schwab.com

Schwab.com has server used 162.93.229.103 (United States) ping response time Hosted in Charles Schwab & Co., Inc. Register Domain Names at MarkMonitor Inc.. This domain has been created 28 years, 286 days ago, remaining 79 days. You can check the 1 Websites and blacklist ip address on this server

Domain information

Registrar WHOIS Server: whois.markmonitor.com

Registrar URL: http://www.markmonitor.com     See All 30,435+

Creation Date: 1993-04-07 28 years, 286 days

Updated Date: 2021-05-20 242 days ago

Expiry Date: 2022-04-08 79 days left     See All

  Sign up for notifications near expiration

Registrar: MarkMonitor Inc.

Abuse Email: [email protected]

Abuse Phone: +1.2083895740

  Full details

Top 10 Hosting Providers

Registrar URLDomain CountsRegistrar NameAbuse Email
www.godaddy.com2,280,668GoDaddy.com, LLC[email protected]
www.tucows.com535,579Tucows Domains Inc.
networksolutions.com526,027Network Solutions, LLC[email protected]
www.namecheap.com333,839NameCheap, Inc.[email protected]
www.enom.com299,925eNom, LLC
www.publicdomainregistry.com294,948PDR Ltd. d/b/a PublicDomainRegistry.com[email protected]
www.whois.godaddy.com174,077GoDaddy.com, LLC[email protected]
www.fastdomain.com161,753FastDomain Inc.[email protected]
www.ionos.com159,2071&1 IONOS SE[email protected]
www.networksolutions.com149,653Network Solutions, LLC[email protected]

Full view & Download

Keywords Suggestions

Schwab login

Schwab

Schwab client login

Schwab.com

Schwab login for clients

Schwab login my account

Schwab advisor center

Schwab alliance

Schwab workplace

Schwab advisor login

Schwab alliance login

Schwab client login my account

Schwab institutional login

Schwab institutional

Schwab bank

Schwabisch gmund news

Schwabe

Schwaben

Schwaba

Schwabach

Schwabl

Schwab bank checking

Schwabenquellen

Schwabing

Schwab online checking

( Please select at least 2 keywords )

See More:   A   B   C   D   E   F   G   H   I   J   K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z  

› Charles schwab financial advisor reviews

› Schwab 401k participant log in

› Charles schwab retirement log in

› Charles schwab alliance home page

› Charles schwab my account

› Charles schwab app store

› Charles schwab office locations

› Schwab account online

Hosting Provider

NetName: SCHWAB2

Organization: Charles Schwab & Co., Inc.     See All 22+

Provider URL: Schwab.com

Hostname: schwab.com

IP Server: 162.93.229.103 Reg: 1992-09-25, Updated: 2021-12-14

Blacklist: Check Backlist Status

Country: United States

Address: 211 Main Street, San Francisco, CA 94105, US

Latitude: 37.789799

Longitude: -122.394203

Name Server:

  • A8-64.AKAM.NET
  • A9-65.AKAM.NET
  • NS1.SCHWAB.COM
  • NS2.SCHWAB.COM
  • NS3.SCHWAB.COM
  • NS4.SCHWAB.COM

Abuse Email: [email protected]

Abuse Phone: +1-877-417-2403

Top 10 Hosting Providers

Website URLDomain CountsOrganizationAbuse Email
Google.com681,421Google LLC[email protected]
Godaddy.com650,706GoDaddy.com, LLC[email protected]
Cloudflare.com637,900Cloudflare, Inc.[email protected]
Endurance.com488,827The Endurance International Group, Inc.[email protected]
Amazon.com439,891Amazon Technologies Inc.[email protected]
297,405Domain Name Services
Amazonaws.com287,121Amazon Technologies Inc.[email protected]
Liquidweb.com159,971Liquid Web, L.L.C[email protected]
Squarespace.com150,667Squarespace, Inc.[email protected]
Ripe.net128,362RIPE Network Coordination Centre[email protected]

Full view & Download

List of found email addresses

  1: [email protected]

Find Websites hosted

1: Schwab.com

At least 1 Sites on this server

Port Scanner (IP: 162.93.229.103)

Login Charles Schwab

  • The Charles Schwab Corporation provides a full range of brokerage, banking and financial advisory services through its operating subsidiaries
  • Its broker-dealer subsidiary, Charles Schwab & Co., Inc
  • ( member SIPC ), offers investment services and products, including Schwab brokerage accounts.

Client.schwab.com   DA: 17 PA: 38 MOZ Rank: 55

Charles Schwab A Modern Approach To Investing & …

  • The Schwab Bank High Yield Investor Checking ®7 account is linked to a Schwab One ® brokerage account so you can easily manage both accounts with a single login
  • There are no monthly account service fees, you'll earn interest on your balance, and your account is FDIC-insured 8 up to $250,000.

Schwab.com   DA: 14 PA: 14 MOZ Rank: 29

Charles Schwab And Co., Inc Log In

  • Forgot Login ID or Password? (1120-0NMB) Charles Schwab & Co., Inc
  • and Charles Schwab Bank, SSB, are separate but affiliated companies and wholly-owned subsidiaries of The Charles Schwab Corporation.

Sws-gateway.schwab.com   DA: 22 PA: 16 MOZ Rank: 40

Charles Schwab Client Center

  • Your Login ID is less secure when you use your Social Security Number, Birth Date, or any other private information
  • and Charles Schwab Bank, SSB are separate but affiliated companies and wholly-owned subsidiaries of The Charles Schwab Corporation.

Client.schwab.com   DA: 17 PA: 41 MOZ Rank: 61

All Accounts Charles Schwab

  • The Schwab One brokerage account has no minimum balance requirements, minimum balance charges, minimum trade requirements, and there is no requirement to fund this account, when opened with a linked High Yield Investor Checking account
  • To learn more about other Schwab Bank checking accounts, please contact Schwab Bank at 1-888-403-9000.

Schwab.com   DA: 14 PA: 9 MOZ Rank: 27

Brokerage Account Charles Schwab

  • The easiest way to open Schwab brokerage account is online
  • You can also get help opening an account by calling us at 866-232- 9890 or visiting one of 300 local branches
  • The online account application process only takes about 10 minutes

Schwab.com   DA: 14 PA: 10 MOZ Rank: 29

Charles Schwab Bank

  • Apply for a Schwab Bank account today! Forgot your User Name? Forgot your password? Learn more about Schwab Bank
  • is not affiliated with Charles Schwab Bank, SSB

Online.schwabbank.com   DA: 21 PA: 17 MOZ Rank: 44

Log In Workplace Financial Services

  • Schwab Compliance Technologies®
  • Log in here to manage your Schwab Compliance Technologies software platform and access resources and tools to help with day-to-day administration
  • Log In to Schwab Compliance Technologies
  • Talk with us about all the options available to your business.

Workplacefinancialservices.schwab.com   DA: 37 PA: 6 MOZ Rank: 50

Login: Plan Participants: Schwab Retirement Plan Center

The Charles Schwab Corporation (Charles Schwab) provides services to retirement and other benefit plans and participants as well as equity compensation plan services and other financial and retirement services to corporations and executives through its separate but affiliated companies and subsidiaries, Schwab Retirement Plan Services, Inc.;

Content.schwabplan.com   DA: 22 PA: 42 MOZ Rank: 72

Schwab Brokerage

Schwab Personal Choice Retirement Account® A Schwab PCRA is a self-directed brokerage account (SDBA) that resides within your employer-sponsored retirement plan and lets you invest in a much wider range of investments.

Workplace.schwab.com   DA: 20 PA: 20 MOZ Rank: 49

Charles Schwab Client Center

  • To place an order for a security listed herein, follow the links provided or contact a Charles Schwab Fixed Income Trading Representative at 1-888-986-3700
  • Fixed income securities are subject to increased loss of principal during periods of rising interest rates
  • Investment value will fluctuate, and bonds, when sold, may be worth more or less

Client.schwab.com   DA: 17 PA: 41 MOZ Rank: 68

Charles Schwab International Why Invest In The U.S. With

  • market with an account designed specifically for international investors
  • Overview Take charge of your U.S
  • trading with a full array of tools and …

International.schwab.com   DA: 24 PA: 24 MOZ Rank: 59

RIA And Financial Advisor Solutions Schwab Advisor Services

  • As an independent financial advisor, you wear many different hats
  • You need a custodian who truly understands your hopes, your dreams, and your headaches
  • Schwab has been there for thousands of advisors over the last three decades
  • And now, we're here to help you build the business you've always wanted
  • 2022 RIA Benchmarking Study opens soon.

Advisorservices.schwab.com   DA: 26 PA: 26 MOZ Rank: 64

SchwabSafe Charles Schwab

  • If you suspect fraud or identify theft with your Schwab account, contact us immediately
  • If you are abroad, call +1-602-355-7300

Schwab.com   DA: 14 PA: 11 MOZ Rank: 38

Workplace Financial Services Charles Schwab

  • Schwab Retirement Plan Services, Inc., provides recordkeeping and related services with respect to retirement plans
  • Schwab Stock Plan Services is a division of Charles Schwab & Co., Inc
  • providing equity compensation plan services and brokerage solutions for corporate clients.

Workplacefinancialservices.schwab.com   DA: 37 PA: 37 MOZ Rank: 88

Schwab Bank Online Security Charles Schwab

Schwab's account protection efforts fall into but are not limited to these categories: Authentication—Secure identification and authentication before initiating transactions We maintain strict rules for the creation of secure user IDs and passwords, designed to stop others from guessing your log in information.

Schwab.com   DA: 14 PA: 27 MOZ Rank: 56

Charles Schwab Log In Help

  • This site supports Microsoft Edge, Google Chrome, and Mozilla Firefox
  • ©2022 Charles Schwab & Co., Inc

Lms.schwab.com   DA: 14 PA: 6 MOZ Rank: 36

Schwab Brokerage

  • To talk to a Schwab Stock Plan Specialist, call 800-654-2593
  • International participants, call +1-602-355-3408
  • Narrator: Or, from your Schwab account, navigate to Equity Awards and click on Knowledge Center
  • Onscreen text: Or from your Schwab account, navigate to Equity Awards and click on Knowledge Center
  • The Charles Schwab logo appears.

Eac.schwab.com   DA: 14 PA: 14 MOZ Rank: 45

401(k) Plan Services Schwab Retirement Plan Services

  • "We" refers to Schwab Retirement Plan Services, Inc
  • At the direction of the Plan Sponsor or Plan Administrator, Participants may have access to advice services that can provide Participants with a retirement savings and investment strategy for their Plan account, furnished by an independent registered investment advisor ("Advisor").

Workplacefinancialservices.schwab.com   DA: 37 PA: 39 MOZ Rank: 94

Schwab Retirement Center

  • For login support please contact Schwab Client Services at [email protected]
  • Any other inquires please call 877-319-2782
  • Charles Schwab Investment Management, Inc
  • (CSIM), Charles Schwab & Co., Inc
  • (Schwab), Charles Schwab Bank, Charles Schwab Trust Bank and Schwab Retirement Technologies, Inc ® are separate but affiliated

Schwabretirementcenter.com   DA: 30 PA: 35 MOZ Rank: 84

Sponsors Charles Schwab

  • Schwab Retirement Plan Services, Inc., provides recordkeeping and related services with respect to retirement plans
  • Schwab Stock Plan Services is a division of Charles Schwab & Co., Inc
  • providing equity compensation plan services and brokerage solutions for corporate clients.

Workplace.schwab.com   DA: 20 PA: 9 MOZ Rank: 49

Charles Schwab-TD Ameritrade Acquisition Client

  • Its broker-dealer subsidiary, Charles Schwab & Co., Inc
  • (Schwab) Member SIPC, offers investment services and products, including the Schwab One ® brokerage account
  • Its banking subsidiary, Charles Schwab Bank, SSB (member FDIC and an Equal Housing Lender), provides deposit and lending services and products.

Welcome.schwab.com   DA: 18 PA: 18 MOZ Rank: 57

Retirement Plan Center Login

  • The Charles Schwab Corporation provides services to retirement and other benefit plans and participants through its separate but affiliated companies and subsidiaries: Charles Schwab Bank; Charles Schwab Trust Bank; Charles Schwab & Co., Inc.; and Schwab Retirement Plan Services, Inc
  • Brokerage products and services are offered by Charles Schwab & Co., Inc

Lms.schwab.com   DA: 14 PA: 6 MOZ Rank: 42

Charles Schwab And Co., Inc

  • Access Denied We were unable to complete your request
  • If this problem persists, please contact a Schwab representative at 800-435-4000.

Lms-mgmt.schwab.com   DA: 19 PA: 8 MOZ Rank: 50

Schwab Alliance Advisor Services

  • Schwab Alliance is a version of the schwab.com website customized specifically for clients of advisors
  • You can customize it with your firm's branding, choose the information your clients see, and more
  • Most importantly, Schwab Alliance is the key to empowering your clients to electronically approve everything from new accounts to move money

Advisorservices.schwab.com   DA: 26 PA: 50 MOZ Rank: 100

Schwab Stock Slices

  • Because Schwab custodial accounts are eligible, investors can use Schwab Stock Slices to get their children or grandchildren engaged with investing in an accessible and educational way
  • Once a Schwab custodial account is open and funded, the custodian can purchase stocks in small dollar amounts in the same way they would in a traditional

Aboutschwab.com   DA: 19 PA: 13 MOZ Rank: 57

Automated Investing Schwab Intelligent Portfolios

  • The portfolios include a cash allocation to a deposit account at Schwab Bank
  • Our affiliated bank earns income on the deposits, and earns more the larger the cash allocation is
  • The lower the interest rate Schwab Bank pays on the cash, the lower the yield
  • Some cash alternatives outside of Schwab Intelligent Portfolios Solutions pay a higher yield.

Intelligent.schwab.com   DA: 22 PA: 22 MOZ Rank: 70

Open An Account Intro Charles Schwab

  • Mailing Service Alert: Schwab currently mails statements, trade confirmations and other account-related material from the United States.Due to the evolving situation of the pandemic, the US Postal Service is unable to deliver mail to a number of international jurisdictions.

International.schwab.com   DA: 24 PA: 19 MOZ Rank: 70

How Do I Get A Charles Schwab Login

  • Creating a Charles Schwab Account
  • To get your Charles Schwab password, you’ll first need to set up an account
  • The brokerage offers retirement accounts — one example is a Charles Schwab 401(k) — as well as estate and charitable planning options
  • If you open a Charles Schwab Bank checking account, it will be automatically linked to a

Gobankingrates.com   DA: 22 PA: 50 MOZ Rank: 100

Charles Schwab Down

  • Charles Schwab is an broker and bank
  • Charles Schwab positions itself as a discount broker, offering lower commissions and fees than some of its competitors
  • Clients can place orders through on of Charles Schwab's offices, online or by phone
  • Charles Schwab in addition to stock broker services also offers checking, savings and mortgages.

Downdetector.com   DA: 16 PA: 23 MOZ Rank: 68

Recently Analyzed

1: Trucaredentalnm.com 8 seconds ago

2: Attorneyrudysalinas.com 1 seconds ago

3: Amiinvestment.com 1 seconds ago

4: Midwestsalt.com 1 seconds ago

5: Spreed.com 1 seconds ago

6: Schwab.com 1 seconds ago

7: Myschooldesk.net 4 seconds ago

8: Aadsmmo.com 1 seconds ago

9: Marksaeratorservice.com 1 seconds ago

10: Chongthamhoangthuy.com 1 seconds ago

Tool Checker

Domain Expiry Date Updated

Expiry DateExpiry DateDomain ProviderHosting Provider
Chongthamhoangthuy.com 74 days leftGoDaddy.com, LLCSuper Online Data Co.,Ltd
Marksaeratorservice.com 250 days leftGoDaddy.com, LLCGoDaddy.com, LLC
Aadsmmo.com 362 days leftNameCheap, Inc.Google LLC
Myschooldesk.net 116 days leftGoDaddy.com, LLCCertified Hosting
Schwab.com 79 days leftMarkMonitor Inc.Charles Schwab & Co., Inc.
Spreed.com 307 days leftHetzner Online GmbHDomain Name Services
Midwestsalt.com 343 days leftGoDaddy.com, LLCGoogle LLC
Amiinvestment.com2 years, 317 days leftNetwork Solutions, LLCWeb.com, Inc.
Attorneyrudysalinas.com 102 days leftGoogle LLCWEBSITEWELCOME.COM
Trucaredentalnm.com 211 days leftGoDaddy.com, LLCThe Endurance International Group, Inc.

<< See All >>

.COM - 10,595,200+   .ORG - 1,117,549+   .EDU - 123,500+   .NET - 792,945+   .GOV - 30,232+   .US - 84,439+   .CA - 122,904+   .DE - 220,061+   .UK - 272,390+   .IT - 108,882+   .AU - 152,812+   .CO - 51,739+   .BIZ - 59,081+   .IO - 32,494+   .NL - 99,647+   .SG - 19,713+   .INFO - 81,589+   .IE - 26,934+   .ME - 25,076+   .FR - 98,576+   .EU - 61,372+   .RU - 165,043+   .PH - 9,511+   .INT - 1,166+   .IN - 87,021+   .ES - 38,035+   .CZ - 71,869+   .VN - 48,920+   .TV - 14,250+   .SITE - 9,829+   .RO - 37,484+   .PL - 44,520+   .PK - 10,373+   .MOBI - 4,464+   .LK - 5,507+   .CN - 66,137+   .CH - 66,914+   .AT - 31,992+  

Email Address Search | IP Address Blacklist Check | Hosting Providers | Domain Providers | Website Error Checker

© 2018 Site-Stats.org. All rights reserved. Email: [email protected]