Workscu.com

Workscu.com has server used 167.99.226.171 (United States) ping response time Hosted in DigitalOcean, LLC Register Domain Names at GoDaddy.com, LLC. This domain has been created 12 years, 279 days ago, remaining 1 year, 85 days. You can check the 1 Websites and blacklist ip address on this server

Domain information

Registrar WHOIS Server: whois.godaddy.com

Registrar URL: http://www.godaddy.com     See All 2,280,668+

Creation Date: 2009-09-28 12 years, 279 days

Updated Date: 2021-09-16 291 days ago

Expiry Date: 2023-09-28 1 year, 85 days left     See All

  Sign up for notifications near expiration

Registrar: GoDaddy.com, LLC

Abuse Email: [email protected]

Abuse Phone: 480-624-2505

  Full details

Top 10 Hosting Providers

Registrar URLDomain CountsRegistrar NameAbuse Email
www.godaddy.com2,280,668GoDaddy.com, LLC[email protected]
www.tucows.com535,579Tucows Domains Inc.
networksolutions.com526,027Network Solutions, LLC[email protected]
www.namecheap.com333,839NameCheap, Inc.[email protected]
www.enom.com299,925eNom, LLC
www.publicdomainregistry.com294,948PDR Ltd. d/b/a PublicDomainRegistry.com[email protected]
www.whois.godaddy.com174,077GoDaddy.com, LLC[email protected]
www.fastdomain.com161,753FastDomain Inc.[email protected]
www.ionos.com159,2071&1 IONOS SE[email protected]
www.networksolutions.com149,653Network Solutions, LLC[email protected]

Full view & Download

Keywords Suggestions

Works cited

World cup qualifiers

Works cited generator

Works cited page

Works cited mla

Workscu

Workscu.com

Worksculpt

Works customer service

Works cup

Works cutter

Works cuyahoga falls

Works cut to edge

Works customer service number

( Please select at least 2 keywords )

See More:   A   B   C   D   E   F   G   H   I   J   K   L   M   N   O   P   Q   R   S   T   U   V   W   X   Y   Z  

Hosting Provider

NetName: DIGITALOCEAN-167-99-0-0

Organization: DigitalOcean, LLC     See All 112,685+

Provider URL: Digitalocean.com

Hostname: workscu.com

IP Server: 167.99.226.171 Reg: 2017-11-10, Updated: 2020-04-03

Blacklist: Check Backlist Status

Country: United States

Address: 101 Ave of the Americas, New York, NY 10013, US

Latitude: 40.721401

Longitude: -74.005203

Name Server:

  • NS35.DOMAINCONTROL.COM
  • NS36.DOMAINCONTROL.COM

Abuse Email: [email protected]

Abuse Phone: +1-347-875-6044

Top 10 Hosting Providers

Website URLDomain CountsOrganizationAbuse Email
Google.com681,421Google LLC[email protected]
Godaddy.com650,706GoDaddy.com, LLC[email protected]
Cloudflare.com637,900Cloudflare, Inc.[email protected]
Endurance.com488,827The Endurance International Group, Inc.[email protected]
Amazon.com439,891Amazon Technologies Inc.[email protected]
297,405Domain Name Services
Amazonaws.com287,121Amazon Technologies Inc.[email protected]
Liquidweb.com159,971Liquid Web, L.L.C[email protected]
Squarespace.com150,667Squarespace, Inc.[email protected]
Ripe.net128,362RIPE Network Coordination Centre[email protected]

Full view & Download

List of found email addresses

  1: [email protected]

Find Websites hosted

1: Workscu.com

At least 1 Sites on this server

Port Scanner (IP: 167.99.226.171)

Login Works Credit Union

  • Login | Works Credit Union Login Please be advised that this service is currently in a testing phase and is not yet available to the public
  • Please keep checking the website for updates on when it will be made available for the general membership’s use.

Workscu.com   DA: 11 PA: 7 MOZ Rank: 18

Works Credit Union Works Credit Union

Log in to your account Member Services Request a service! Deposit & Share Withdrawal Complete and submit to [email protected] What's New Check out our latest products & promotions I visited your office on Dundonald Street, POS …

Workscu.com   DA: 11 PA: 11 MOZ Rank: 23

WCU E-Branch Service Works Credit Union

onlinebanking ebranch eservice convenience Now you can access your Account ANYTIME from any internet-ready mobile device! Now you can Transfer funds between Accounts Top up your VISA Debit Card Check your balances and keep track of your monthly transactions Request statements and embassy letters via secure messaging And much more

Workscu.com   DA: 11 PA: 46 MOZ Rank: 59

Member Services Works Credit Union

    Workscu.com   DA: 11 PA: 16 MOZ Rank: 30

    About Us Works Credit Union

    • Works Credit Union is committed to the service and upliftment of its members/owners by providing them with convenient and competitive financial services, together with enriching social and educational programmes within the Co-operative Philosophy, while promoting the thrift and prudently managing its resources

    Workscu.com   DA: 11 PA: 10 MOZ Rank: 25

    Trusted MA, New England Credit Union Workers Credit Union MA

    • Login Setup Online Access Forgot Username/Password Other Logins
    • Garrett is Achieving His Dreams, The Workers Way Watch His Story The Workers Wayᵀᴹ Improve My Financial Wellness Open a New Account Apply for a Loan Shop for Insurance Manage My Wealth Find a Branch Near Me Schedule an Appointment

    Wcu.com   DA: 11 PA: 11 MOZ Rank: 27

    WORKS CREDIT UNION

    We provide Simple Financial Solutions that Works for YOU; Works for ME; Works for EVERYBODY! 8-10 Dundonald Street, City of Port-of-Spain, Trinidad and Tobago

    Facebook.com   DA: 16 PA: 8 MOZ Rank: 30

    Google Workspace Business Apps & Collaboration Tools

    • Similar to G Suite, all Google Workspace plans provide a custom email for your business and include collaboration tools like Gmail, Calendar, Meet, Chat, Drive, Docs, Sheets, Slides, Forms, Sites, and more
    • For additional details, visit our plans and pricing page .

    Workspace.google.com   DA: 20 PA: 20 MOZ Rank: 47

    Collaboration Software For Business Workplace From Meta

    • Collaboration software for business with Workplace from Meta
    • Use familiar collaboration tools like video calling and Live video to collaborate.

    Workplace.com   DA: 17 PA: 17 MOZ Rank: 42

    Sign In To Access Workspace

      Go.access-workspace.com.au   DA: 26 PA: 6 MOZ Rank: 41

      Log In Workplace Financial Services

      • Designated Brokerage clients can log in to this customized portal to access real-time reports on balances, positions, transactions, and more.

      Workplacefinancialservices.schwab.com   DA: 37 PA: 6 MOZ Rank: 53

      Minnequa Works Credit Union

      • The Board of Directors and Management of Minnequa Works Credit Union has made the necessary decision to close the NEPCO Branch Drive Thru on Saturdays effective March 12, 2022
      • The Drive-Thru’s at Eagleridge Branch – 4700 Eagleridge Circle 81008 and Main Office – 1549 E
      • 81004 will have new Saturday hours: Open 8:30 am to 12

      Mymwcu.com   DA: 10 PA: 10 MOZ Rank: 31

      Works Credit Union Co-operative Society Ltd.

      • Works Credit Union Co-operative Society Ltd
      • Mobile Banking allows you to check balances, view transaction history, transfer funds, and pay loans & bills on the go!

      Play.google.com   DA: 15 PA: 19 MOZ Rank: 46

      Recently Analyzed

      1: B9good.com 6 seconds ago

      2: Mundtravel.com 6 seconds ago

      3: Ckingart.com 6 seconds ago

      4: Autographrequest.com 4 seconds ago

      5: Activelifefitness.net 3 seconds ago

      6: Totalfutbolacademy.com 0 seconds ago

      7: Wisemal.com 5 seconds ago

      8: Navata.com 8 seconds ago

      9: Workscu.com 0 seconds ago

      10: Wrongshots.com 11 seconds ago

      Tool Checker

      Domain Expiry Date Updated

      Expiry DateExpiry DateDomain ProviderHosting Provider
      Wrongshots.com 152 days leftWest263 International LimitedEGIHosting
      Workscu.com1 year, 85 days leftGoDaddy.com, LLCDigitalOcean, LLC
      Navata.com1 year, 296 days leftGoDaddy.com, LLCTransferred to the RIPE region on 2018-08-27T14:42:34Z.
      Wisemal.com 178 days leftPDR Ltd. d/b/a PublicDomainRegistry.comLeaseweb USA, Inc.
      Totalfutbolacademy.com 103 days leftGoDaddy.com, LLCCloudflare, Inc.
      Activelifefitness.net 98 days leftGoDaddy.com, LLCGoogle LLC
      Autographrequest.com 141 days leftNameCheap, Inc.Namecheap, Inc.
      Ckingart.com 8 days leftGoDaddy.com, LLCGoDaddy.com, LLC
      Mundtravel.com 250 days leftHosting Concepts B.V. d/b/a OpenproviderPSINet, Inc.
      B9good.com 194 days leftGoDaddy.com, LLCFDCservers.net

      << See All >>

      .COM - 10,595,200+   .ORG - 1,117,549+   .EDU - 123,500+   .NET - 792,945+   .GOV - 30,232+   .US - 84,439+   .CA - 122,904+   .DE - 220,061+   .UK - 272,390+   .IT - 108,882+   .AU - 152,812+   .CO - 51,739+   .BIZ - 59,081+   .IO - 32,494+   .NL - 99,647+   .SG - 19,713+   .INFO - 81,589+   .IE - 26,934+   .ME - 25,076+   .FR - 98,576+   .EU - 61,372+   .RU - 165,043+   .PH - 9,511+   .INT - 1,166+   .IN - 87,021+   .ES - 38,035+   .CZ - 71,869+   .VN - 48,920+   .TV - 14,250+   .SITE - 9,829+   .RO - 37,484+   .PL - 44,520+   .PK - 10,373+   .MOBI - 4,464+   .LK - 5,507+   .CN - 66,137+   .CH - 66,914+   .AT - 31,992+  

      Email Address Search | IP Address Blacklist Check | Hosting Providers | Domain Providers | Website Error Checker

      © 2018 Site-Stats.org. All rights reserved. Email: [email protected]